PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G1639
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 280aa    MW: 30780.5 Da    PI: 7.0066
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G1639genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1254e-0889135551
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                  k  +r   NReA r++R++ ka+ + Le++v  L a N++L k+l+ 
  Gh_D01G1639  89 KSKKRPLGNREAVRKYREKVKARAASLEDEVVRLRALNQQLVKRLQG 135
                  77899999**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-785152IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.2E-1286153No hitNo description
PfamPF077161.6E-1387142IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.29E-589135No hitNo description
CDDcd146863.94E-1191144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDDGELDYSN QEVFSVNNMG DIPSSCSMDS FFDELLNDSH ACTHTHTCNP PGPDNSHTHT  60
CFHFHTKIVP ASSEDKAAID GTAVSGENKS KKRPLGNREA VRKYREKVKA RAASLEDEVV  120
RLRALNQQLV KRLQGQAALE AEVARLKCLL VDIRGRIEGE IGPFPYQKPA TNVNMMNVPG  180
AYVMNPCNVP CNDQMYCLHP GFEDKTGEAA ALNGQGFNGC DFDNIQCLAN QNSTGGIGSA  240
GSNGNYSGTK RRKGKSLGVF LLIFSHNFCH NFCRYWNVNL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5790555e-91JX579055.1 Gossypium hirsutum clone NBRI_GE11220 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467574.10.0PREDICTED: uncharacterized protein LOC105785918 isoform X1
RefseqXP_012467573.10.0PREDICTED: uncharacterized protein LOC105785918 isoform X1
SwissprotQ8VY761e-112BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A0D2Q9760.0A0A0D2Q976_G
STRINGVIT_03s0038g02420.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-113bZIP family protein